PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC24601_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 351aa    MW: 38211.6 Da    PI: 6.7128
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC24601_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-3951111262
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  k++a++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrn+PvGgg+rknk+s+
  RrC24601_p1  51 KDQAINCPRCNSVNTKFCYYNNYSLTQPRFFCKGCRRYWTEGGSLRNIPVGGGSRKNKRSH 111
                  7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2949109IPR003851Zinc finger, Dof-type
PfamPF027015.4E-3352109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.41655109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPLEEIVT NTCPTPQASE PQPPPSVGEA GGAERKTRPE KDQAINCPRC  60
NSVNTKFCYY NNYSLTQPRF FCKGCRRYWT EGGSLRNIPV GGGSRKNKRS HSSSTSSSSD  120
ISRNYLDSTQ PATKKHHSDQ HHHHHLISIS QQGLTGQNPK ILETTQQDLG FSPHGLIRTN  180
FTDLIHNIGN NNTSTNNPFL GSSCSATSAL AISPLDLIRN NNGNNRNTSN SSFMGFPVHN  240
QGPTSEGFSM QDHYKPSNSN TTLLGFSLDH HDDNSGFHGG FQGGEEREDG DDVNGRDLFP  300
FEDLKLPVSS SSATINVDVN DHQKRTSGGD ADAAATSGGY WTGMLSGGSW C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109305.10.0PREDICTED: dof zinc finger protein DOF4.6-like isoform X2
SwissprotQ8LAP81e-164DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLM4D2480.0M4D248_BRARP; Uncharacterized protein
STRINGBra010548.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-139Dof family protein